HPA023438

ZBTB37 antibody from MilliporeSigma / Merck KGaA
MGC2629, ZNF908
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023438
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023438, RRID:AB_1858954
Product name
Anti-ZBTB37 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023438
Antibody type
Polyclonal
Antigen
Zinc finger and BTB domain-containing protein 37 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEESTSPQIIEPSSDVESREPILRINRAGQWYVET
GVADRGGRSDDEVRVLGAVHIKTENLEEWLGPENQ
PSGEDGSSA
Storage
-20C
Provider Type Product Number
- No reagents -