HPA025753

CACYBP antibody from Atlas Antibodies
S100A6BP, SIP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA025753
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025753, RRID:AB_1845878
Product name
Anti-CACYBP
Provider product page
Atlas Antibodies - HPA025753
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSK
IETEIKNKMQQKSQKKAELLDNEKPAAVVAPITT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -