HPA025753

CACYBP antibody from Sigma-Aldrich
S100A6BP, SIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025753
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025753, RRID:AB_1845878
Product name
Anti-CACYBP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025753
Antibody type
Polyclonal
Antigen
Calcyclin-binding protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSK
IETEIKNKMQQKSQKKAELLDNEKPAAVVAPITT
Storage
-20C
Provider Type Product Number
- No reagents -