HPA025753

CACYBP antibody from MilliporeSigma / Merck KGaA
S100A6BP, SIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025753
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-CACYBP antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA025753
Antibody type
Polyclonal
Antigen
Calcyclin-binding protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSK
IETEIKNKMQQKSQKKAELLDNEKPAAVVAPITT
Storage
-20C