Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003098-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003098-M01, RRID:AB_534892
- Product name
- HK1 monoclonal antibody (M01), clone 5G9
- Antibody type
- Monoclonal
- Antigen
- HK1 (NP_277031, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Reactivity
- Human
- Host
- Mouse
- Antigen sequence
NQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGD
FMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITW
TKRFKASGVEGADVVKLLNKAIKKRGDYDA- Isotype
- IgG
- Vial size
- 50 µg
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Induction of hexokinase I expression in normal and diabetic rats by a brassinosteroid isoform.
Muthuraman P, Srikumar K
European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences 2010 Sep 11;41(1):1-9
European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences 2010 Sep 11;41(1):1-9
No comments: Submit comment
No validations: Submit validation data