HPA027134

TNR antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027134
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027134, RRID:AB_1851983
Product name
Anti-TNR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027134
Antibody type
Polyclonal
Antigen
Tenascin-R Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QGLQFKTITETTVEVQWEPFSFSFDGWEISFIPKN
NEGGVIAQVPSDVTSFNQTGLKPGEEYIVNVVALK
Storage
-20C
Provider Type Product Number
- No reagents -