HPA020453

RASAL2 antibody from Atlas Antibodies
nGAP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020453
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020453, RRID:AB_1856086
Product name
Anti-RASAL2
Provider product page
Atlas Antibodies - HPA020453
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LSVLHSLLWEVVSQLDKATVAKLGPLPRVLADITK
SLTNPTPIQQQLRRFTEHNSSPNVSGSLSSGLQKI
FEDPT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -