HPA018805

RASAL2 antibody from Sigma-Aldrich
nGAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018805
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018805, RRID:AB_1856085
Product name
Anti-RASAL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018805
Antibody type
Polyclonal
Antigen
Ras GTPase-activating protein nGAP recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PRQNSTGQAQIRKVDQGGLGARAKAPPSLPHSASL
RSTGSMSVVSAALVAEPVQNGSRSRQQSSSSRESP
VPKVRAIQRQQTQQVQSPVDSATMSPVERTAAWVL
NNGQY
Storage
-20C
Provider Type Product Number
- No reagents -