HPA020453

RASAL2 antibody from Sigma-Aldrich
nGAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020453
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020453, RRID:AB_1856086
Product name
Anti-RASAL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020453
Antibody type
Polyclonal
Antigen
Ras GTPase-activating protein nGAP recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSVLHSLLWEVVSQLDKATVAKLGPLPRVLADITK
SLTNPTPIQQQLRRFTEHNSSPNVSGSLSSGLQKI
FEDPT
Storage
-20C
Provider Type Product Number
- No reagents -