HPA007045

GNE antibody from Sigma-Aldrich
IBM2, Uae1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007045
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007045, RRID:AB_1079003
Product name
Anti-GNE antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007045
Antibody type
Polyclonal
Antigen
Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DDFDINTRLHTIVRGEDEAAMVESVGLALVKLPDV
LNRLKPDIMIVHGDRFDALALATSAALMNIRILHI
EGGEVSGTIDDSIRHAITKLAHYHVCCTRSAEQHL
ISMCEDHDRILLAGCPSYDKLLSAKNKD
Storage
-20C
Provider Type Product Number
- No reagents -