Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309687 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Torsin Family 3, Member A (TOR3A) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TOR3A antibody: synthetic peptide directed towards the middle region of human TOR3A
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
FHFPHPKYVDLYKEQLMSQIRETQQLCHQTLFIFD
EAEKL HPGLLEVLGP- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Relative tissue expression of homologous torsinB correlates with the neuronal specific importance of DYT1 dystonia-associated torsinA.
Molecular cloning of ADIR, a novel interferon responsive gene encoding a protein related to the torsins.
Jungwirth M, Dear ML, Brown P, Holbrook K, Goodchild R
Human molecular genetics 2010 Mar 1;19(5):888-900
Human molecular genetics 2010 Mar 1;19(5):888-900
Molecular cloning of ADIR, a novel interferon responsive gene encoding a protein related to the torsins.
Dron M, Meritet JF, Dandoy-Dron F, Meyniel JP, Maury C, Tovey MG
Genomics 2002 Mar;79(3):315-25
Genomics 2002 Mar;79(3):315-25
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting