Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109283 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Torsin Family 3, Member A (TOR3A) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TOR3A antibody: synthetic peptide directed towards the middle region of human TOR3A.
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
FHFPHPKYVDLYKEQLMSQIRETQQLCHQTLFIFD
EAEKLHPGLLEVLGP- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Molecular cloning of ADIR, a novel interferon responsive gene encoding a protein related to the torsins.
Dron M, Meritet JF, Dandoy-Dron F, Meyniel JP, Maury C, Tovey MG
Genomics 2002 Mar;79(3):315-25
Genomics 2002 Mar;79(3):315-25
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human HepG2; Host: Rabbit. Target Name: TOR3A. Sample Tissue: HepG2 Whole cell lysates. Antibody Dilution: 1.0ug/ml.; TOR3A antibody - middle region (AP42179PU-N) in Human HepG2 cells using Western Blot