HPA028766

TOR3A antibody from Sigma-Aldrich
ADIR, ADIR2, FLJ22345
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028766
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028766, RRID:AB_10602251
Product name
Anti-TOR3A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028766
Antibody type
Polyclonal
Antigen
torsin family 3, member A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLRGDIINEVVLKLLKAGWSREEITMEHLEPHLQA
EIVETIDNGFGHSRLVKENLIDYFIPFLPLEYRHV
RLCARDA
Storage
-20C
Provider Type Product Number
- No reagents -