HPA016563

XPR1 antibody from Sigma-Aldrich
SLC53A1, SYG1, X3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016563
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016563, RRID:AB_1858881
Product name
Anti-XPR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016563
Antibody type
Polyclonal
Antigen
Xenotropic and polytropic retrovirus receptor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EWRKQYIQYEAFKDMLYSAQDQAPSVEVTDEDTVK
RYFAKFEEKFFQTCEKELAKINTFYSEKLAEAQRR
FATLQNELQSSLDAQKESTGVTTLRQRRKPVFHLS
HE
Storage
-20C
Provider Type Product Number
- No reagents -