HPA007105

ALPL antibody from Sigma-Aldrich
HOPS, TNSALP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007105
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007105, RRID:AB_1078137
Product name
Anti-ALPL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007105
Antibody type
Polyclonal
Antigen
Alkaline phosphatase, tissue-nonspecific isozyme precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLA
PMLSDTDKKPFTAILYGNGPGYKVVGGERENVSMV
DYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAH
LLHGVHEQNYVPHVMAYAACIGANL
Storage
-20C
Provider Type Product Number
- No reagents -