HPA008765

ALPL antibody from Sigma-Aldrich
HOPS, TNSALP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008765
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008765, RRID:AB_1078138
Product name
Anti-ALPL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008765
Antibody type
Polyclonal
Antigen
Alkaline phosphatase, tissue-nonspecific isozyme precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKT
DVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSH
FIWNRTELLTLDPHNVDYLLGLFEPGDMQYELNRN
NVTDPSLSEMVVVA
Storage
-20C
Provider Type Product Number
- No reagents -