Antibody data

Product number
H00006948-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006948-M01, RRID:AB_1581275
Product name
TCN2 monoclonal antibody (M01), clone 2F4
Provider product page
Abnova Corporation - H00006948-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant TCN2.
Antigen sequence
MRHLGAFLFLLGVLGALTEMCEIPEMDSHLVEKSG
QHLLPWMDRLSLEHLNPSIYVGLRLSSLQAGTKED
LYLHSLKLGYQQCLLGSAFSEDDGDCQGKPSMGQL
ALYLLALRANWHDHKGHPHTSYYQYGLGILALCLH
QKRVHDSVVDKLLYAVEPFHQGHHSVDTAAMAGLA
FTCLKRSNFNPGRRQRITMAIRTVREEILKAQTPE
GHFGNVYSTPLALQFLMTSPMRGAELGTACLKARV
ALLASLQDGAFQNALMISQLLPVLNHKTYIDLIFP
DCLAPRVMLEPAAETIPQTQEIISVTLQVLSLLPP
YRQSISVLAGSTVEDVLKKAHELGGFTYETQASLS
GPYLTSVMGKAAGEREFWQLLRDPNTPLLQGIADY
RPKDGETIELRLVSW
Isotype
IgG
Antibody clone number
2F4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -