HPA000837

TCN2 antibody from Sigma-Aldrich
D22S676, D22S750, TC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000837
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000837, RRID:AB_1080235
Product name
Anti-TCN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000837
Antibody type
Polyclonal
Antigen
Transcobalamin-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLYAVEPFHQGHHSVAAMAGLAFTCLKRSNFNPGR
RQRITMAIRTVREEILKAQTPEGHFGNVYSTPLAL
QFLMTSPMRGAELGTACLKARVALLASLQDGAFQN
ALMISQLLPVLNHKTYIDLIFPDCLAPRVMLEPAA
ETIPQTQEIISVTLQVLSLLPPYRQSISVLAGSTV
EDV
Storage
-20C
Provider Type Product Number
- No reagents -