Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406003 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Mitogen-Activated Protein Kinase Kinase Kinase Kinase 2 (MAP4K2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MAP4K2 antibody: synthetic peptide directed towards the N terminal of human MAP4K2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
HLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFL
KLALT KNPKKRPTAE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
Wissing J, Jänsch L, Nimtz M, Dieterich G, Hornberger R, Kéri G, Wehland J, Daub H
Molecular & cellular proteomics : MCP 2007 Mar;6(3):537-47
Molecular & cellular proteomics : MCP 2007 Mar;6(3):537-47
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting