HPA007330

MAP4K2 antibody from Sigma-Aldrich
BL44, GCK, RAB8IP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007330
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007330, RRID:AB_1079361
Product name
Anti-MAP4K2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007330
Antibody type
Polyclonal
Antigen
Mitogen-activated protein kinase kinase kinase kinase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETDPLNEPWEEEWTLLGKEELSGSLLQSVQEALEE
RSLTIRSASEFQELDSPDDTMGTIKRAPFLGPLPT
DPPAEEPLSSPPGTLPPPPSGPNSSPLLPTAWATM
KQRE
Storage
-20C
Provider Type Product Number
- No reagents -