Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023179-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023179-M01, RRID:AB_509369
- Product name
- RGL1 monoclonal antibody (M01), clone 2D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RGL1.
- Antigen sequence
EVKPVGEPTQEVSKFKLSTKVESTGHWLVEDHVRI
WEVLKTEESSIQDWGEEVEEGAVYHVTLKRVQIQQ
AANKGARWLGVEGDQLPPGHTVSQYETCKIRTIKA
GTL- Isotype
- IgG
- Antibody clone number
- 2D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The anti-inflammatory TIPE2 is an inhibitor of the oncogenic Ras.
Gus-Brautbar Y, Johnson D, Zhang L, Sun H, Wang P, Zhang S, Zhang L, Chen YH
Molecular cell 2012 Mar 9;45(5):610-8
Molecular cell 2012 Mar 9;45(5):610-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RGL1 monoclonal antibody (M01), clone 2D10 Western Blot analysis of RGL1 expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RGL1 expression in transfected 293T cell line by RGL1 monoclonal antibody (M01), clone 2D10.Lane 1: RGL1 transfected lysate(90.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RGL1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RGL1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol