HPA019788

RGL1 antibody from Sigma-Aldrich
RGL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019788
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019788, RRID:AB_1856215
Product name
Anti-RGL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019788
Antibody type
Polyclonal
Antigen
Ral guanine nucleotide dissociation stimulator-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PHFPCLQKLLDYLTRMMPGSDPERRAQNLLEQFQK
QEVETDNGLPNTISFSLEEEEELEGGESAEFTCFS
EDLVAEQLTYMDAQLFKKVVPHHCLGCIWSRRD
Storage
-20C
Provider Type Product Number
- No reagents -