HPA026831

C1orf21 antibody from Sigma-Aldrich
PIG13
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026831
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026831, RRID:AB_1845636
Product name
Anti-C1orf21 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026831
Antibody type
Polyclonal
Antigen
Uncharacterized protein C1orf21 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AKHVATVQNEEEAQKGKNYQNGDVFGDEYRIKPVE
EVKYMKNGAEEEQKIAARNQENLEKSASSNVRLKT
NKEVPGLVHQPRANMHISESQQEFFRMLDEKIEKG
RDYCSEE
Storage
-20C
Provider Type Product Number
- No reagents -