HPA025754

EDEM3 antibody from Atlas Antibodies
C1orf22
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA025754
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025754, RRID:AB_1845638
Product name
Anti-EDEM3
Provider product page
Atlas Antibodies - HPA025754
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YLYLLFADKEDIIFDIEDYIFTTEAHLLPLWLSTT
NQSISKKNTTSEYTELDDSNFDWTCPNTQILFPND
PLYAQSIREPL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -