HPA025755

EDEM3 antibody from Sigma-Aldrich
C1orf22
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025755
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025755, RRID:AB_1845639
Product name
Anti-EDEM3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025755
Antibody type
Polyclonal
Antigen
ER degradation-enhancing alpha-mannosidase-like 3 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FRSGAKPPLRARDFMATNPEHLEILKKMGVSLIHL
KDGRVQLVQHAIQAASSIDAEDGLRFMQEMIELSS
QQQKEQQLPPRAVQIVSHPFFGRVVLTAGP
Storage
-20C
Provider Type Product Number
- No reagents -