HPA026803

RNF2 antibody from Sigma-Aldrich
BAP-1, BAP1, DING, HIPI3, RING1B, RING2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026803
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026803, RRID:AB_10602086
Product name
Anti-RNF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026803
Antibody type
Polyclonal
Antigen
ring finger protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALISKIYPSRDEYEAHQERVLARINKHNNQQALSH
SIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSS
HCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNA
AMAIDPVMDGASEIELV
Storage
-20C
Provider Type Product Number
- No reagents -