HPA007446

CDKL3 antibody from Sigma-Aldrich
NKIAMRE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007446
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007446, RRID:AB_1079487
Product name
Anti-CDKL3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007446
Antibody type
Polyclonal
Antigen
Cyclin-dependent kinase-like 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AKVNSLIKPKESSKENELRKDERKTVYTNTLLSSS
VLGKEIEKEKKPKEIKVRVIKVKGGRGDISEPKKK
EYEGGLGQQDANENVHPMSPDTKLVTIEPPNPINP
STNCN
Storage
-20C
Provider Type Product Number
- No reagents -