HPA027751

CDKL3 antibody from MilliporeSigma / Merck KGaA
NKIAMRE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027751
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027751, RRID:AB_10601256
Product name
Anti-CDKL3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027751
Antibody type
Polyclonal
Antigen
cyclin-dependent kinase-like 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GGSVTMPPINLTNSNLMAANLSSNLFHPSVRLTER
AKKRRTSSQSIGQVMPNSRQEDPGPIQSQMEKGIF
NERTGHSDQMANENKRKLNFSRSDRKEFHFPELPV
TIQSKDTKGMEVKQIKMLKRESKKTESSKIPTLL
Storage
-20C
Provider Type Product Number
- No reagents -