HPA024214

SWT1 antibody from Atlas Antibodies
C1orf26, FLJ20121, HsSwt1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024214
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024214, RRID:AB_1845642
Product name
Anti-SWT1
Provider product page
Atlas Antibodies - HPA024214
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VRILKTTEVPGFDKLVLIIPWVVMQELDRMKEGKL
LKRAQHKAIPAVHFINDSLKNQDRKLWGQSIQLAS
QKHYGLSDENNDDRVLKCCLQHQE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -