HPA027334

SWT1 antibody from Atlas Antibodies
C1orf26, FLJ20121, HsSwt1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027334
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027334, RRID:AB_1845643
Product name
Anti-SWT1
Provider product page
Atlas Antibodies - HPA027334
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ALTTSNIASFEEAFICLQKLMAAVRDILEGIQRIL
APNSDYQDVETLYNFLIKYEVNKNVKFTAQEIYDC
VSQTEYREKLTIGC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -