HPA024214

SWT1 antibody from Sigma-Aldrich
C1orf26, FLJ20121, HsSwt1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024214
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024214, RRID:AB_1845642
Product name
Anti-C1orf26 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024214
Antibody type
Polyclonal
Antigen
Uncharacterized protein C1orf26 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VRILKTTEVPGFDKLVLIIPWVVMQELDRMKEGKL
LKRAQHKAIPAVHFINDSLKNQDRKLWGQSIQLAS
QKHYGLSDENNDDRVLKCCLQHQE
Storage
-20C
Provider Type Product Number
- No reagents -