WH0064407M1

RGS18 antibody from MilliporeSigma / Merck KGaA
RGS13
ELISA
Recommended by provider

Antibody data

Product number
WH0064407M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0064407M1, RRID:AB_1843332
Product name
Monoclonal Anti-RGS18 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0064407M1
Antibody type
Monoclonal
Antigen
RGS18 (AAH20632, a.a. 1-236) full-length recombinant protein with GST tag.
Description
ascites fluid
Reactivity
Human
Antigen sequence
METTLLFFSQINMCESKEKTFFKLIHGSGKEETSK
EAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLA
KETRVSPEEAVKWGESFDKLLSHRDGLEAFTRFLK
TEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYE
KFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDA
AQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPT
NLRRRSRSFTCNEFQDVQSDVAIWL* (without
GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -