HPA045780

RGS18 antibody from Atlas Antibodies
RGS13
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA045780
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA045780, RRID:AB_10962728
Product name
Anti-RGS18
Provider product page
Atlas Antibodies - HPA045780
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIR
AKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRV
SPEEAVKWGES
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -