Antibody data

Product number
H00064407-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00064407-M02, RRID:AB_1712928
Product name
RGS18 monoclonal antibody (M02), clone 1G12
Provider product page
Abnova Corporation - H00064407-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant RGS18.
Antigen sequence
METTLLFFSQINMCESKEKTFFKLIHGSGKEETSK
EAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLA
KETRVSPEEAVKWGESFDKLLSHRDGLEAFTRFLK
TEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYE
KFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDA
AQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPT
NLRRRSRSFTCNEFQDVQSDVAIWL
Isotype
IgG
Antibody clone number
1G12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -