Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA044952 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA044952, RRID:AB_10964914
- Product name
- Anti-RGS13
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENL
MATKYGPVVYAAYLKMEHSDENIQFWMACET- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Expression Levels of 4 Genes in Colon Tissue Might Be Used to Predict Which Patients Will Enter Endoscopic Remission After Vedolizumab Therapy for Inflammatory Bowel Diseases
Verstockt B, Verstockt S, Veny M, Dehairs J, Arnauts K, Van Assche G, De Hertogh G, Vermeire S, Salas A, Ferrante M
Clinical Gastroenterology and Hepatology 2020;18(5):1142-1151.e10
Clinical Gastroenterology and Hepatology 2020;18(5):1142-1151.e10
No comments: Submit comment
No validations: Submit validation data