HPA009027

ULK2 antibody from Sigma-Aldrich
ATG1B, KIAA0623, Unc51.2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009027
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009027, RRID:AB_1080458
Product name
Anti-ULK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009027
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase ULK2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVRRSNTSPMGFLRPGSCSPVPADTAQTVGRRLST
GSSRPYSPSPLVGTIPEQFSQCCCGHPQGHDSRSR
NSSGSPVPQAQSPQSLLSGARLQSAPTLTDIYQNK
QKLRKQHSDPVCPSHTGAGYSYSPQPSRPGSLGTS
PTKH
Storage
-20C
Provider Type Product Number
- No reagents -