HPA018193

NEK7 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018193
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018193, RRID:AB_1854372
Product name
Anti-NEK7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018193
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase Nek7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VCLLPVWERRVCALNACYFLEIIKGSESLQYMATL
TNLFENLPVSHHGSFA
Storage
-20C
Provider Type Product Number
- No reagents -