HPA026511

antibody from Atlas Antibodies

Targeting: CAMSAP2 CAMSAP1L1, KIAA1078

Antibody data

Submit

Validation data

Product number: HPA026511 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA026511, RRID:AB_1852378
Product name: Anti-CAMSAP2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TKGALSPITDNTEVDTGIHVPSEDIPETMDEDSSL RDYTVSLDSDMDDASKFLQDYDIRTGNTREALSPC PSTVSTKSQPGSSASSSSGVKM
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CAMSAP2 protein structure - HPA026511 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-CAMSAP2 antibody. Corresponding CAMSAP2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-CAMSAP2 antibody HPA026511 (A) shows similar protein distribution across tissues to independent antibody HPA026304 (B).
Antibody #2 product nr: HPA026304, HPA027302
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-CAMSAP2 antibody HPA026511.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-CAMSAP2 antibody HPA026511.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-CAMSAP2 antibody HPA026511.
Sample type: HUMAN