HPA027302

antibody from Atlas Antibodies

Targeting: CAMSAP2 CAMSAP1L1, KIAA1078

Antibody data

Submit

Validation data

Product number: HPA027302 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA027302, RRID:AB_1852380
Product name: Anti-CAMSAP2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KLVTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVS IEKVIACAQQYSAFFQATDLPYDIEDAVMYWINKV NEHLKDIMEQEQKLKEHHTVEAPGG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CAMSAP2 protein structure - HPA027302 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-CAMSAP2 antibody HPA027302 (A) shows similar protein distribution across tissues to independent antibody HPA026304 (B).
Antibody #2 product nr: HPA026304, HPA026511
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows distinct positivity in neuronal and glial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-CAMSAP2 antibody HPA027302.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-CAMSAP2 antibody HPA027302.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-CAMSAP2 antibody HPA027302.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-CAMSAP2 antibody HPA027302.
Sample type: HUMAN