HPA026304

CAMSAP2 antibody from Sigma-Aldrich
CAMSAP1L1, KIAA1078
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026304
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026304, RRID:AB_1852376
Product name
Anti-CAMSAP1L1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026304
Antibody type
Polyclonal
Antigen
Calmodulin-regulated spectrin-associated protein 1-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSVHGVSFDISFDKEDSVQRSTPNRGITRSISNEG
LTLNNSHVSKHIRKNLSFKPINGEEEAESIEEELN
IDSHSDLKSCVPL
Storage
-20C
Provider Type Product Number
- No reagents -