HPA017205

AC013461.1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017205
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017205, RRID:AB_1858933
Product name
Anti-ZAK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017205
Antibody type
Polyclonal
Antigen
Mitogen-activated protein kinase kinase kinase MLT recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYS
YGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLT
IPSSCPRSFAELLHQCWEADAKKRPSFKQIISILE
SMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKK
LERDLSFKE
Storage
-20C
Provider Type Product Number
- No reagents -