HPA024640

PPP1R12B antibody from Sigma-Aldrich
MGC131980, MGC87886, MYPT2, PP1bp55
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024640
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024640, RRID:AB_1854265
Product name
Anti-PPP1R12B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024640
Antibody type
Polyclonal
Antigen
Protein phosphatase 1 regulatory subunit 12B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TQGVTLTDLQEAERTFSRSRAERQAQEQPREKPTD
TEGLEGSPEKHEPSAVPATEAGEGQQPWGRSLDEE
PICHRLRCPAQPDKPTTPASPSTSRPSLYTSSHLL
W
Storage
-20C
Provider Type Product Number
- No reagents -