H00010765-M02
antibody from Abnova Corporation
		Targeting: KDM5B
		
		CT31, JARID1B, PLU-1, PPP1R98, RBBP2H1A	
	
	
	
	
Antibody data
- Antibody Data
 - Antigen structure
 - References [3]
 - Comments [0]
 - Validations
 - Western blot [1]
 - ELISA [1]
 - Immunocytochemistry [1]
 - Immunohistochemistry [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00010765-M02 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00010765-M02, RRID:AB_1112409
 - Product name
 - KDM5B monoclonal antibody (M02), clone 1G10
 - Antibody type
 - Monoclonal
 - Description
 - Mouse monoclonal antibody raised against a partial recombinant KDM5B.
 - Antigen sequence
 AKRMRAEAMNIKIEPEETTEARTHNLRRRMGCPTP
KCENEKEMKSSIKQEPIERKDYIVENEKEKPKSRS
KKATNAVDLYVCLLCGSGN- Isotype
 - IgG
 - Antibody clone number
 - 1G10
 - Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
Submitted references		Jumonji/ARID1 B (JARID1B) protein promotes breast tumor cell cycle progression through epigenetic repression of microRNA let-7e.
				
Overexpression of the JmjC histone demethylase KDM5B in human carcinogenesis: involvement in the proliferation of cancer cells through the E2F/RB pathway.
				
JARID1B is a histone H3 lysine 4 demethylase up-regulated in prostate cancer.
				
		
	
			Mitra D, Das PM, Huynh FC, Jones FE
The Journal of biological chemistry 2011 Nov 25;286(47):40531-5
		The Journal of biological chemistry 2011 Nov 25;286(47):40531-5
Overexpression of the JmjC histone demethylase KDM5B in human carcinogenesis: involvement in the proliferation of cancer cells through the E2F/RB pathway.
			Hayami S, Yoshimatsu M, Veerakumarasivam A, Unoki M, Iwai Y, Tsunoda T, Field HI, Kelly JD, Neal DE, Yamaue H, Ponder BA, Nakamura Y, Hamamoto R
Molecular cancer 2010 Mar 13;9:59
		Molecular cancer 2010 Mar 13;9:59
JARID1B is a histone H3 lysine 4 demethylase up-regulated in prostate cancer.
			Xiang Y, Zhu Z, Han G, Ye X, Xu B, Peng Z, Ma Y, Yu Y, Lin H, Chen AP, Chen CD
Proceedings of the National Academy of Sciences of the United States of America 2007 Dec 4;104(49):19226-31
		Proceedings of the National Academy of Sciences of the United States of America 2007 Dec 4;104(49):19226-31
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - KDM5B monoclonal antibody (M02), clone 1G10. Western Blot analysis of KDM5B expression in HeLa.
 - Protocol
 - Protocol
 
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Detection limit for recombinant GST tagged KDM5B is approximately 0.03ng/ml as a capture antibody.
 - Validation comment
 - Sandwich ELISA (Recombinant protein)
 - Protocol
 - Protocol
 
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunofluorescence of monoclonal antibody to KDM5B on HeLa cell . [antibody concentration 10 ug/ml]
 - Validation comment
 - Immunofluorescence
 - Protocol
 - Protocol
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunoperoxidase of monoclonal antibody to KDM5B on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ug/ml]
 - Validation comment
 - Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
 - Protocol
 - Protocol