HPA007419

MAP4K1 antibody from Sigma-Aldrich
HPK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007419
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007419, RRID:AB_1853778
Product name
Anti-MAP4K1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007419
Antibody type
Polyclonal
Antigen
Mitogen-activated protein kinase kinase kinase kinase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTH
RSSSLGIPDADCCRRHMEFRKLRGMETRPPANTAR
LQPPRDLRSSSPRKQLSESSDDDYDDVDIPTPAED
TPPPLPPKPKFRSPS
Storage
-20C
Provider Type Product Number
- No reagents -