HPA017064

TESK1 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017064
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA017064, RRID:AB_1857903
Product name
Anti-TESK1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017064
Antibody type
Polyclonal
Antigen
Dual specificity testis-specific protein kinase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NFISTCSSASQPWSPRSGPVLNNNPPAVVVNSPQG
WAGEPWNRAQHSLPRAAALERTEPSPPPSAPREPD
EGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLN
CEAGSLLCHR
Storage
-20C
Provider Type Product Number
- No reagents -