HPA023809

CAMK1G antibody from Sigma-Aldrich
CLICKIII, dJ272L16.1, VWS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023809
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023809, RRID:AB_1845937
Product name
Anti-CAMK1G antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023809
Antibody type
Polyclonal
Antigen
Calcium/calmodulin-dependent protein kinase type 1G recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WRQAFNAAAVVHHMRKLHMNLHSPGVRPEVENRPP
ETQASETSRPSSPEITITEAPVLDHSVALPALTQL
PCQH
Storage
-20C
Provider Type Product Number
- No reagents -