HPA005998

TEX33 antibody from Atlas Antibodies
C22orf33, EAN57, MGC35206
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005998
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005998, RRID:AB_888783
Product name
Anti-TEX33
Provider product page
Atlas Antibodies - HPA005998
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SSRENRATSGEGAQPCQGTDDGPSLGAQDQRSTPT
NQKGSIIPNNIRHKFGSNVVDQLVSEEQAQKAIDE
VFEGQKRASSWPSRTQNPVEISSVFSDYYDLGYNM
RSNLFRGAAEETKSLMKASYTPEVIEKS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -