HPA005998

TEX33 antibody from Sigma-Aldrich
C22orf33, EAN57, MGC35206
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005998
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005998, RRID:AB_1078352
Product name
Anti-C22orf33 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005998
Antibody type
Polyclonal
Antigen
Protein EAN57 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSRENRATSGEGAQPCQGTDDGPSLGAQDQRSTPT
NQKGSIIPNNIRHKFGSNVVDQLVSEEQAQKAIDE
VFEGQKRASSWPSRTQNPVEISSVFSDYYDLGYNM
RSNLFRGAAEETKSLMKASYTPEVIEKS
Storage
-20C
Provider Type Product Number
- No reagents -