ABIN486967

IRF6 antibody from antibodies-online
LPS, OFC6, VWS, VWS1

Antibody data

Product number
ABIN486967
Provider
antibodies-online
Product name
anti-Interferon Regulatory Factor 6 (IRF6) (Middle Region) antibody
Provider product page
antibodies-online - ABIN486967
Antibody type
Polyclonal
Antigen
The immunogen for anti-IRF6 antibody: synthetic peptide directed towards the middle region of human IRF6
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
IPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIK
DNIVA QLKQLYRILQ
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -