ABIN501730

IRF6 antibody from antibodies-online
LPS, OFC6, VWS, VWS1

Antibody data

Product number
ABIN501730
Provider
antibodies-online
Product name
anti-Interferon Regulatory Factor 6 (IRF6) (Middle Region) antibody
Provider product page
antibodies-online - ABIN501730
Antibody type
Polyclonal
Antigen
The immunogen for anti-IRF6 antibody: synthetic peptide directed towards the middle region of human IRF6
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Porcine
Host
Rabbit
Antigen sequence
GSVRLQISTPDIKDNIVAQLKQLYRILQTQESWQP
MQPTP SMQLPPALPP
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -