Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310490 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interferon Regulatory Factor 6 (IRF6) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IRF6 antibody: synthetic peptide directed towards the C terminal of human IRF6
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPL
ERKLI LVQVIPVVAR- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Large-scale characterization of HeLa cell nuclear phosphoproteins.
Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villén J, Li J, Cohn MA, Cantley LC, Gygi SP
Proceedings of the National Academy of Sciences of the United States of America 2004 Aug 17;101(33):12130-5
Proceedings of the National Academy of Sciences of the United States of America 2004 Aug 17;101(33):12130-5
No comments: Submit comment
No validations: Submit validation data